Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067039-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRDX4
Alternative Gene Name: AOE37-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025289: 98%, ENSRNOG00000003763: 98%
Entrez Gene ID: 10549
Uniprot ID: Q13162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL |
| Gene Sequence | HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL |
| Gene ID - Mouse | ENSMUSG00000025289 |
| Gene ID - Rat | ENSRNOG00000003763 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) | |
| Datasheet | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) | |
| Datasheet | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) |