Anti PRDM9 pAb (ATL-HPA059555)

Atlas Antibodies

SKU:
ATL-HPA059555-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PR domain containing 9
Gene Name: PRDM9
Alternative Gene Name: MSBP3, PFM6, ZNF899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051977: 63%, ENSRNOG00000021493: 66%
Entrez Gene ID: 56979
Uniprot ID: Q9NQV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG
Gene Sequence QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG
Gene ID - Mouse ENSMUSG00000051977
Gene ID - Rat ENSRNOG00000021493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRDM9 pAb (ATL-HPA059555)
Datasheet Anti PRDM9 pAb (ATL-HPA059555) Datasheet (External Link)
Vendor Page Anti PRDM9 pAb (ATL-HPA059555) at Atlas Antibodies

Documents & Links for Anti PRDM9 pAb (ATL-HPA059555)
Datasheet Anti PRDM9 pAb (ATL-HPA059555) Datasheet (External Link)
Vendor Page Anti PRDM9 pAb (ATL-HPA059555)



Citations for Anti PRDM9 pAb (ATL-HPA059555) – 1 Found
Hadziselimovic, Faruk; Cathomas, Gieri; Verkauskas, Gilvydas; Dasevicius, Darius; Stadler, Michael B. PRDM Histone Methyltransferase mRNA Levels Increase in Response to Curative Hormone Treatment for Cryptorchidism-Dependent Male Infertility. Genes. 2018;9(8)  PubMed