Anti PRDM9 pAb (ATL-HPA059555)
Atlas Antibodies
- SKU:
- ATL-HPA059555-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRDM9
Alternative Gene Name: MSBP3, PFM6, ZNF899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051977: 63%, ENSRNOG00000021493: 66%
Entrez Gene ID: 56979
Uniprot ID: Q9NQV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG |
Gene Sequence | QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG |
Gene ID - Mouse | ENSMUSG00000051977 |
Gene ID - Rat | ENSRNOG00000021493 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRDM9 pAb (ATL-HPA059555) | |
Datasheet | Anti PRDM9 pAb (ATL-HPA059555) Datasheet (External Link) |
Vendor Page | Anti PRDM9 pAb (ATL-HPA059555) at Atlas Antibodies |
Documents & Links for Anti PRDM9 pAb (ATL-HPA059555) | |
Datasheet | Anti PRDM9 pAb (ATL-HPA059555) Datasheet (External Link) |
Vendor Page | Anti PRDM9 pAb (ATL-HPA059555) |
Citations for Anti PRDM9 pAb (ATL-HPA059555) – 1 Found |
Hadziselimovic, Faruk; Cathomas, Gieri; Verkauskas, Gilvydas; Dasevicius, Darius; Stadler, Michael B. PRDM Histone Methyltransferase mRNA Levels Increase in Response to Curative Hormone Treatment for Cryptorchidism-Dependent Male Infertility. Genes. 2018;9(8) PubMed |