Anti PRDM7 pAb (ATL-HPA059944)

Atlas Antibodies

Catalog No.:
ATL-HPA059944-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PR domain containing 7
Gene Name: PRDM7
Alternative Gene Name: ZNF910
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026116: 29%, ENSRNOG00000053250: 28%
Entrez Gene ID: 11105
Uniprot ID: Q9NQW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP
Gene Sequence ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP
Gene ID - Mouse ENSMUSG00000026116
Gene ID - Rat ENSRNOG00000053250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM7 pAb (ATL-HPA059944)
Datasheet Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link)
Vendor Page Anti PRDM7 pAb (ATL-HPA059944) at Atlas Antibodies

Documents & Links for Anti PRDM7 pAb (ATL-HPA059944)
Datasheet Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link)
Vendor Page Anti PRDM7 pAb (ATL-HPA059944)