Anti PRDM7 pAb (ATL-HPA059944)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059944-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PRDM7
Alternative Gene Name: ZNF910
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026116: 29%, ENSRNOG00000053250: 28%
Entrez Gene ID: 11105
Uniprot ID: Q9NQW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP |
| Gene Sequence | ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP |
| Gene ID - Mouse | ENSMUSG00000026116 |
| Gene ID - Rat | ENSRNOG00000053250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRDM7 pAb (ATL-HPA059944) | |
| Datasheet | Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link) |
| Vendor Page | Anti PRDM7 pAb (ATL-HPA059944) at Atlas Antibodies |
| Documents & Links for Anti PRDM7 pAb (ATL-HPA059944) | |
| Datasheet | Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link) |
| Vendor Page | Anti PRDM7 pAb (ATL-HPA059944) |