Anti PRDM7 pAb (ATL-HPA059944)
Atlas Antibodies
- SKU:
- ATL-HPA059944-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRDM7
Alternative Gene Name: ZNF910
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026116: 29%, ENSRNOG00000053250: 28%
Entrez Gene ID: 11105
Uniprot ID: Q9NQW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP |
Gene Sequence | ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP |
Gene ID - Mouse | ENSMUSG00000026116 |
Gene ID - Rat | ENSRNOG00000053250 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRDM7 pAb (ATL-HPA059944) | |
Datasheet | Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link) |
Vendor Page | Anti PRDM7 pAb (ATL-HPA059944) at Atlas Antibodies |
Documents & Links for Anti PRDM7 pAb (ATL-HPA059944) | |
Datasheet | Anti PRDM7 pAb (ATL-HPA059944) Datasheet (External Link) |
Vendor Page | Anti PRDM7 pAb (ATL-HPA059944) |