Anti PRDM6 pAb (ATL-HPA030324)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030324-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRDM6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069378: 96%, ENSRNOG00000030486: 94%
Entrez Gene ID: 93166
Uniprot ID: Q9NQX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG |
| Gene Sequence | RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG |
| Gene ID - Mouse | ENSMUSG00000069378 |
| Gene ID - Rat | ENSRNOG00000030486 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRDM6 pAb (ATL-HPA030324) | |
| Datasheet | Anti PRDM6 pAb (ATL-HPA030324) Datasheet (External Link) |
| Vendor Page | Anti PRDM6 pAb (ATL-HPA030324) at Atlas Antibodies |
| Documents & Links for Anti PRDM6 pAb (ATL-HPA030324) | |
| Datasheet | Anti PRDM6 pAb (ATL-HPA030324) Datasheet (External Link) |
| Vendor Page | Anti PRDM6 pAb (ATL-HPA030324) |