Anti PRDM6 pAb (ATL-HPA030324)

Atlas Antibodies

Catalog No.:
ATL-HPA030324-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PR domain containing 6
Gene Name: PRDM6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069378: 96%, ENSRNOG00000030486: 94%
Entrez Gene ID: 93166
Uniprot ID: Q9NQX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG
Gene Sequence RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG
Gene ID - Mouse ENSMUSG00000069378
Gene ID - Rat ENSRNOG00000030486
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM6 pAb (ATL-HPA030324)
Datasheet Anti PRDM6 pAb (ATL-HPA030324) Datasheet (External Link)
Vendor Page Anti PRDM6 pAb (ATL-HPA030324) at Atlas Antibodies

Documents & Links for Anti PRDM6 pAb (ATL-HPA030324)
Datasheet Anti PRDM6 pAb (ATL-HPA030324) Datasheet (External Link)
Vendor Page Anti PRDM6 pAb (ATL-HPA030324)