Anti PRDM4 pAb (ATL-HPA067437)

Atlas Antibodies

Catalog No.:
ATL-HPA067437-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PR domain containing 4
Gene Name: PRDM4
Alternative Gene Name: PFM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035529: 93%, ENSRNOG00000004962: 95%
Entrez Gene ID: 11108
Uniprot ID: Q9UKN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMC
Gene Sequence FCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMC
Gene ID - Mouse ENSMUSG00000035529
Gene ID - Rat ENSRNOG00000004962
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM4 pAb (ATL-HPA067437)
Datasheet Anti PRDM4 pAb (ATL-HPA067437) Datasheet (External Link)
Vendor Page Anti PRDM4 pAb (ATL-HPA067437) at Atlas Antibodies

Documents & Links for Anti PRDM4 pAb (ATL-HPA067437)
Datasheet Anti PRDM4 pAb (ATL-HPA067437) Datasheet (External Link)
Vendor Page Anti PRDM4 pAb (ATL-HPA067437)