Anti PRDM4 pAb (ATL-HPA024322)

Atlas Antibodies

Catalog No.: ATL-HPA024322-25

Protein Description: PR domain containing 4
Gene Name: PRDM4
Alternative Gene Name: PFM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035529: 96%, ENSRNOG00000004962: 95%
Entrez Gene ID: 11108
Uniprot ID: Q9UKN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVSPSLQMEDSNSNKENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPLIG
• Gene Sequence: LSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVSPSLQMEDSNSNKENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPLIG
• Gene ID - Mouse: ENSMUSG00000035529
• Gene ID - Rat: ENSRNOG00000004962
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRDM4 pAb (ATL-HPA024322) – 1 Found

Bogani, Debora; Morgan, Marc A J; Nelson, Andrew C; Costello, Ita; McGouran, Joanna F; Kessler, Benedikt M; Robertson, Elizabeth J; Bikoff, Elizabeth K. The PR/SET domain zinc finger protein Prdm4 regulates gene expression in embryonic stem cells but plays a nonessential role in the developing mouse embryo. Molecular And Cellular Biology. 2013;33(19):3936-50.