Anti PRDM16 pAb (ATL-HPA060467)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060467-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRDM16
Alternative Gene Name: KIAA1675, MEL1, MGC166915, PFM13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039410: 84%, ENSRNOG00000045913: 84%
Entrez Gene ID: 63976
Uniprot ID: Q9HAZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYS |
| Gene Sequence | YKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYS |
| Gene ID - Mouse | ENSMUSG00000039410 |
| Gene ID - Rat | ENSRNOG00000045913 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRDM16 pAb (ATL-HPA060467) | |
| Datasheet | Anti PRDM16 pAb (ATL-HPA060467) Datasheet (External Link) |
| Vendor Page | Anti PRDM16 pAb (ATL-HPA060467) at Atlas Antibodies |
| Documents & Links for Anti PRDM16 pAb (ATL-HPA060467) | |
| Datasheet | Anti PRDM16 pAb (ATL-HPA060467) Datasheet (External Link) |
| Vendor Page | Anti PRDM16 pAb (ATL-HPA060467) |