Anti PRDM12 pAb (ATL-HPA043143)

Atlas Antibodies

Catalog No.: ATL-HPA043143-25

Protein Description: PR domain containing 12
Gene Name: PRDM12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079466: 100%, ENSRNOG00000009218: 100%
Entrez Gene ID: 59335
Uniprot ID: Q9H4Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTF
• Gene Sequence: MWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTF
• Gene ID - Mouse: ENSMUSG00000079466
• Gene ID - Rat: ENSRNOG00000009218
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.