Anti PRDM11 pAb (ATL-HPA057072)

Atlas Antibodies

Catalog No.:
ATL-HPA057072-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PR domain containing 11
Gene Name: PRDM11
Alternative Gene Name: PFM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075028: 96%, ENSRNOG00000008674: 93%
Entrez Gene ID: 56981
Uniprot ID: Q9NQV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQD
Gene Sequence QVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQD
Gene ID - Mouse ENSMUSG00000075028
Gene ID - Rat ENSRNOG00000008674
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM11 pAb (ATL-HPA057072)
Datasheet Anti PRDM11 pAb (ATL-HPA057072) Datasheet (External Link)
Vendor Page Anti PRDM11 pAb (ATL-HPA057072) at Atlas Antibodies

Documents & Links for Anti PRDM11 pAb (ATL-HPA057072)
Datasheet Anti PRDM11 pAb (ATL-HPA057072) Datasheet (External Link)
Vendor Page Anti PRDM11 pAb (ATL-HPA057072)