Anti PRDM11 pAb (ATL-HPA057072)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057072-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRDM11
Alternative Gene Name: PFM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075028: 96%, ENSRNOG00000008674: 93%
Entrez Gene ID: 56981
Uniprot ID: Q9NQV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQD |
Gene Sequence | QVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQD |
Gene ID - Mouse | ENSMUSG00000075028 |
Gene ID - Rat | ENSRNOG00000008674 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRDM11 pAb (ATL-HPA057072) | |
Datasheet | Anti PRDM11 pAb (ATL-HPA057072) Datasheet (External Link) |
Vendor Page | Anti PRDM11 pAb (ATL-HPA057072) at Atlas Antibodies |
Documents & Links for Anti PRDM11 pAb (ATL-HPA057072) | |
Datasheet | Anti PRDM11 pAb (ATL-HPA057072) Datasheet (External Link) |
Vendor Page | Anti PRDM11 pAb (ATL-HPA057072) |