Anti PRDM10 pAb (ATL-HPA061749)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061749-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PRDM10
Alternative Gene Name: KIAA1231, MGC131802, PFM7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042496: 99%, ENSRNOG00000007853: 99%
Entrez Gene ID: 56980
Uniprot ID: Q9NQV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA |
| Gene Sequence | LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA |
| Gene ID - Mouse | ENSMUSG00000042496 |
| Gene ID - Rat | ENSRNOG00000007853 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRDM10 pAb (ATL-HPA061749) | |
| Datasheet | Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link) |
| Vendor Page | Anti PRDM10 pAb (ATL-HPA061749) at Atlas Antibodies |
| Documents & Links for Anti PRDM10 pAb (ATL-HPA061749) | |
| Datasheet | Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link) |
| Vendor Page | Anti PRDM10 pAb (ATL-HPA061749) |