Anti PRDM10 pAb (ATL-HPA061749)

Atlas Antibodies

Catalog No.:
ATL-HPA061749-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PR/SET domain 10
Gene Name: PRDM10
Alternative Gene Name: KIAA1231, MGC131802, PFM7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042496: 99%, ENSRNOG00000007853: 99%
Entrez Gene ID: 56980
Uniprot ID: Q9NQV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
Gene Sequence LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
Gene ID - Mouse ENSMUSG00000042496
Gene ID - Rat ENSRNOG00000007853
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM10 pAb (ATL-HPA061749)
Datasheet Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link)
Vendor Page Anti PRDM10 pAb (ATL-HPA061749) at Atlas Antibodies

Documents & Links for Anti PRDM10 pAb (ATL-HPA061749)
Datasheet Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link)
Vendor Page Anti PRDM10 pAb (ATL-HPA061749)