Anti PRDM1 pAb (ATL-HPA075427)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075427-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PRDM1
Alternative Gene Name: BLIMP1, PRDI-BF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038151: 88%, ENSRNOG00000000323: 91%
Entrez Gene ID: 639
Uniprot ID: O75626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN |
Gene Sequence | VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN |
Gene ID - Mouse | ENSMUSG00000038151 |
Gene ID - Rat | ENSRNOG00000000323 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRDM1 pAb (ATL-HPA075427) | |
Datasheet | Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link) |
Vendor Page | Anti PRDM1 pAb (ATL-HPA075427) at Atlas Antibodies |
Documents & Links for Anti PRDM1 pAb (ATL-HPA075427) | |
Datasheet | Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link) |
Vendor Page | Anti PRDM1 pAb (ATL-HPA075427) |