Anti PRDM1 pAb (ATL-HPA075427)

Atlas Antibodies

Catalog No.:
ATL-HPA075427-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: PR/SET domain 1
Gene Name: PRDM1
Alternative Gene Name: BLIMP1, PRDI-BF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038151: 88%, ENSRNOG00000000323: 91%
Entrez Gene ID: 639
Uniprot ID: O75626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
Gene Sequence VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
Gene ID - Mouse ENSMUSG00000038151
Gene ID - Rat ENSRNOG00000000323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRDM1 pAb (ATL-HPA075427)
Datasheet Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link)
Vendor Page Anti PRDM1 pAb (ATL-HPA075427) at Atlas Antibodies

Documents & Links for Anti PRDM1 pAb (ATL-HPA075427)
Datasheet Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link)
Vendor Page Anti PRDM1 pAb (ATL-HPA075427)