Anti PRDM1 pAb (ATL-HPA075427)

Atlas Antibodies

Catalog No.: ATL-HPA075427-100

Protein Description: PR/SET domain 1
Gene Name: PRDM1
Alternative Gene Name: BLIMP1, PRDI-BF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038151: 88%, ENSRNOG00000000323: 91%
Entrez Gene ID: 639
Uniprot ID: O75626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
• Gene Sequence: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
• Gene ID - Mouse: ENSMUSG00000038151
• Gene ID - Rat: ENSRNOG00000000323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.