Anti PRCC pAb (ATL-HPA019481)

Atlas Antibodies

Catalog No.: ATL-HPA019481-25

Protein Description: papillary renal cell carcinoma (translocation-associated)
Gene Name: PRCC
Alternative Gene Name: RCCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004895: 87%, ENSRNOG00000012933: 89%
Entrez Gene ID: 5546
Uniprot ID: Q92733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS
• Gene Sequence: PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS
• Gene ID - Mouse: ENSMUSG00000004895
• Gene ID - Rat: ENSRNOG00000012933
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.