Anti PRCC pAb (ATL-HPA019481)

Atlas Antibodies

Catalog No.:
ATL-HPA019481-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: papillary renal cell carcinoma (translocation-associated)
Gene Name: PRCC
Alternative Gene Name: RCCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004895: 87%, ENSRNOG00000012933: 89%
Entrez Gene ID: 5546
Uniprot ID: Q92733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS
Gene Sequence PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS
Gene ID - Mouse ENSMUSG00000004895
Gene ID - Rat ENSRNOG00000012933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRCC pAb (ATL-HPA019481)
Datasheet Anti PRCC pAb (ATL-HPA019481) Datasheet (External Link)
Vendor Page Anti PRCC pAb (ATL-HPA019481) at Atlas Antibodies

Documents & Links for Anti PRCC pAb (ATL-HPA019481)
Datasheet Anti PRCC pAb (ATL-HPA019481) Datasheet (External Link)
Vendor Page Anti PRCC pAb (ATL-HPA019481)