Anti PRCC pAb (ATL-HPA019463 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019463-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: papillary renal cell carcinoma (translocation-associated)
Gene Name: PRCC
Alternative Gene Name: RCCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004895: 100%, ENSRNOG00000012933: 100%
Entrez Gene ID: 5546
Uniprot ID: Q92733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKY
Gene Sequence RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKY
Gene ID - Mouse ENSMUSG00000004895
Gene ID - Rat ENSRNOG00000012933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRCC pAb (ATL-HPA019463 w/enhanced validation)
Datasheet Anti PRCC pAb (ATL-HPA019463 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRCC pAb (ATL-HPA019463 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRCC pAb (ATL-HPA019463 w/enhanced validation)
Datasheet Anti PRCC pAb (ATL-HPA019463 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRCC pAb (ATL-HPA019463 w/enhanced validation)