Anti PRAP1 pAb (ATL-HPA052451)

Atlas Antibodies

Catalog No.:
ATL-HPA052451-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline rich acidic protein 1
Gene Name: PRAP1
Alternative Gene Name: UPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025467: 44%, ENSRNOG00000018446: 54%
Entrez Gene ID: 118471
Uniprot ID: Q96NZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR
Gene Sequence AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR
Gene ID - Mouse ENSMUSG00000025467
Gene ID - Rat ENSRNOG00000018446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRAP1 pAb (ATL-HPA052451)
Datasheet Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link)
Vendor Page Anti PRAP1 pAb (ATL-HPA052451) at Atlas Antibodies

Documents & Links for Anti PRAP1 pAb (ATL-HPA052451)
Datasheet Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link)
Vendor Page Anti PRAP1 pAb (ATL-HPA052451)