Anti PRAP1 pAb (ATL-HPA052451)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052451-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRAP1
Alternative Gene Name: UPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025467: 44%, ENSRNOG00000018446: 54%
Entrez Gene ID: 118471
Uniprot ID: Q96NZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR |
| Gene Sequence | AVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGR |
| Gene ID - Mouse | ENSMUSG00000025467 |
| Gene ID - Rat | ENSRNOG00000018446 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRAP1 pAb (ATL-HPA052451) | |
| Datasheet | Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link) |
| Vendor Page | Anti PRAP1 pAb (ATL-HPA052451) at Atlas Antibodies |
| Documents & Links for Anti PRAP1 pAb (ATL-HPA052451) | |
| Datasheet | Anti PRAP1 pAb (ATL-HPA052451) Datasheet (External Link) |
| Vendor Page | Anti PRAP1 pAb (ATL-HPA052451) |