Anti PRAP1 pAb (ATL-HPA038713)

Atlas Antibodies

Catalog No.: ATL-HPA038713-25

Protein Description: proline rich acidic protein 1
Gene Name: PRAP1
Alternative Gene Name: UPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025467: 43%, ENSRNOG00000018446: 46%
Entrez Gene ID: 118471
Uniprot ID: Q96NZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYH
• Gene Sequence: PILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYH
• Gene ID - Mouse: ENSMUSG00000025467
• Gene ID - Rat: ENSRNOG00000018446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRAP1 pAb (ATL-HPA038713) – 1 Found

Kim, Tae Hoon; Jeong, Jae-Wook. Proline-Rich Acidic Protein 1 (PRAP1) is a Target of ARID1A and PGR in the Murine Uterus. Development & Reproduction. 2019;23(3):277-284.