Anti PRAM1 pAb (ATL-HPA045236)

Atlas Antibodies

Catalog No.: ATL-HPA045236-25

Protein Description: PML-RARA regulated adaptor molecule 1
Gene Name: PRAM1
Alternative Gene Name: PML-RAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032739: 93%, ENSRNOG00000039204: 91%
Entrez Gene ID: 84106
Uniprot ID: Q96QH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP
• Gene Sequence: QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP
• Gene ID - Mouse: ENSMUSG00000032739
• Gene ID - Rat: ENSRNOG00000039204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.