Anti PRAM1 pAb (ATL-HPA045236)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045236-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRAM1
Alternative Gene Name: PML-RAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032739: 93%, ENSRNOG00000039204: 91%
Entrez Gene ID: 84106
Uniprot ID: Q96QH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP |
Gene Sequence | QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP |
Gene ID - Mouse | ENSMUSG00000032739 |
Gene ID - Rat | ENSRNOG00000039204 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRAM1 pAb (ATL-HPA045236) | |
Datasheet | Anti PRAM1 pAb (ATL-HPA045236) Datasheet (External Link) |
Vendor Page | Anti PRAM1 pAb (ATL-HPA045236) at Atlas Antibodies |
Documents & Links for Anti PRAM1 pAb (ATL-HPA045236) | |
Datasheet | Anti PRAM1 pAb (ATL-HPA045236) Datasheet (External Link) |
Vendor Page | Anti PRAM1 pAb (ATL-HPA045236) |