Anti PRAF2 pAb (ATL-HPA002859 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002859-25

Protein Description: PRA1 domain family, member 2
Gene Name: PRAF2
Alternative Gene Name: JM4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031149: 98%, ENSRNOG00000057147: 95%
Entrez Gene ID: 11230
Uniprot ID: O60831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
• Gene Sequence: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
• Gene ID - Mouse: ENSMUSG00000031149
• Gene ID - Rat: ENSRNOG00000057147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRAF2 pAb (ATL-HPA002859 w/enhanced validation) – 1 Found

Koomoa, Dana-Lynn T; Go, Ramon Christopher V; Wester, Kenneth; Bachmann, André S. Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles. Neuroscience Letters. 2008;436(2):171-6.