Anti PRAC1 pAb (ATL-HPA047871)

Atlas Antibodies

Catalog No.:
ATL-HPA047871-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: prostate cancer susceptibility candidate 1
Gene Name: PRAC1
Alternative Gene Name: C17orf92, PRAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046679: 34%, ENSRNOG00000029260: 32%
Entrez Gene ID: 84366
Uniprot ID: Q96KF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
Gene Sequence MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
Gene ID - Mouse ENSMUSG00000046679
Gene ID - Rat ENSRNOG00000029260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRAC1 pAb (ATL-HPA047871)
Datasheet Anti PRAC1 pAb (ATL-HPA047871) Datasheet (External Link)
Vendor Page Anti PRAC1 pAb (ATL-HPA047871) at Atlas Antibodies

Documents & Links for Anti PRAC1 pAb (ATL-HPA047871)
Datasheet Anti PRAC1 pAb (ATL-HPA047871) Datasheet (External Link)
Vendor Page Anti PRAC1 pAb (ATL-HPA047871)