Anti PQLC2L pAb (ATL-HPA054395)

Atlas Antibodies

Catalog No.:
ATL-HPA054395-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PQ loop repeat containing 2-like
Gene Name: PQLC2L
Alternative Gene Name: C3orf55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028744: 29%, ENSRNOG00000017706: 29%
Entrez Gene ID: 152078
Uniprot ID: A1A4F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLP
Gene Sequence KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLP
Gene ID - Mouse ENSMUSG00000028744
Gene ID - Rat ENSRNOG00000017706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PQLC2L pAb (ATL-HPA054395)
Datasheet Anti PQLC2L pAb (ATL-HPA054395) Datasheet (External Link)
Vendor Page Anti PQLC2L pAb (ATL-HPA054395) at Atlas Antibodies

Documents & Links for Anti PQLC2L pAb (ATL-HPA054395)
Datasheet Anti PQLC2L pAb (ATL-HPA054395) Datasheet (External Link)
Vendor Page Anti PQLC2L pAb (ATL-HPA054395)