Anti PQLC2L pAb (ATL-HPA054395)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054395-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PQLC2L
Alternative Gene Name: C3orf55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028744: 29%, ENSRNOG00000017706: 29%
Entrez Gene ID: 152078
Uniprot ID: A1A4F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLP |
Gene Sequence | KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLP |
Gene ID - Mouse | ENSMUSG00000028744 |
Gene ID - Rat | ENSRNOG00000017706 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PQLC2L pAb (ATL-HPA054395) | |
Datasheet | Anti PQLC2L pAb (ATL-HPA054395) Datasheet (External Link) |
Vendor Page | Anti PQLC2L pAb (ATL-HPA054395) at Atlas Antibodies |
Documents & Links for Anti PQLC2L pAb (ATL-HPA054395) | |
Datasheet | Anti PQLC2L pAb (ATL-HPA054395) Datasheet (External Link) |
Vendor Page | Anti PQLC2L pAb (ATL-HPA054395) |