Anti PQLC1 pAb (ATL-HPA051666)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051666-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PQLC1
Alternative Gene Name: FLJ22378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034006: 88%, ENSRNOG00000059215: 90%
Entrez Gene ID: 80148
Uniprot ID: Q8N2U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTK |
| Gene Sequence | ETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTK |
| Gene ID - Mouse | ENSMUSG00000034006 |
| Gene ID - Rat | ENSRNOG00000059215 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PQLC1 pAb (ATL-HPA051666) | |
| Datasheet | Anti PQLC1 pAb (ATL-HPA051666) Datasheet (External Link) |
| Vendor Page | Anti PQLC1 pAb (ATL-HPA051666) at Atlas Antibodies |
| Documents & Links for Anti PQLC1 pAb (ATL-HPA051666) | |
| Datasheet | Anti PQLC1 pAb (ATL-HPA051666) Datasheet (External Link) |
| Vendor Page | Anti PQLC1 pAb (ATL-HPA051666) |
| Citations for Anti PQLC1 pAb (ATL-HPA051666) – 1 Found |
| Inoue, A; Okamoto, K; Fujino, Y; Nakagawa, T; Muguruma, N; Sannomiya, K; Mitsui, Y; Takaoka, T; Kitamura, S; Miyamoto, H; Okahisa, T; Fujimori, T; Imoto, I; Takayama, T. B-RAF mutation and accumulated gene methylation in aberrant crypt foci (ACF), sessile serrated adenoma/polyp (SSA/P) and cancer in SSA/P. British Journal Of Cancer. 2015;112(2):403-12. PubMed |