Anti PQLC1 pAb (ATL-HPA051666)

Atlas Antibodies

Catalog No.:
ATL-HPA051666-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PQ loop repeat containing 1
Gene Name: PQLC1
Alternative Gene Name: FLJ22378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034006: 88%, ENSRNOG00000059215: 90%
Entrez Gene ID: 80148
Uniprot ID: Q8N2U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTK
Gene Sequence ETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTK
Gene ID - Mouse ENSMUSG00000034006
Gene ID - Rat ENSRNOG00000059215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PQLC1 pAb (ATL-HPA051666)
Datasheet Anti PQLC1 pAb (ATL-HPA051666) Datasheet (External Link)
Vendor Page Anti PQLC1 pAb (ATL-HPA051666) at Atlas Antibodies

Documents & Links for Anti PQLC1 pAb (ATL-HPA051666)
Datasheet Anti PQLC1 pAb (ATL-HPA051666) Datasheet (External Link)
Vendor Page Anti PQLC1 pAb (ATL-HPA051666)
Citations for Anti PQLC1 pAb (ATL-HPA051666) – 1 Found
Inoue, A; Okamoto, K; Fujino, Y; Nakagawa, T; Muguruma, N; Sannomiya, K; Mitsui, Y; Takaoka, T; Kitamura, S; Miyamoto, H; Okahisa, T; Fujimori, T; Imoto, I; Takayama, T. B-RAF mutation and accumulated gene methylation in aberrant crypt foci (ACF), sessile serrated adenoma/polyp (SSA/P) and cancer in SSA/P. British Journal Of Cancer. 2015;112(2):403-12.  PubMed