Anti PPP6R1 pAb (ATL-HPA063681)

Atlas Antibodies

Catalog No.:
ATL-HPA063681-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 6, regulatory subunit 1
Gene Name: PPP6R1
Alternative Gene Name: KIAA1115, SAP190, SAPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052296: 70%, ENSRNOG00000018090: 73%
Entrez Gene ID: 22870
Uniprot ID: Q9UPN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPP
Gene Sequence ATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPP
Gene ID - Mouse ENSMUSG00000052296
Gene ID - Rat ENSRNOG00000018090
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP6R1 pAb (ATL-HPA063681)
Datasheet Anti PPP6R1 pAb (ATL-HPA063681) Datasheet (External Link)
Vendor Page Anti PPP6R1 pAb (ATL-HPA063681) at Atlas Antibodies

Documents & Links for Anti PPP6R1 pAb (ATL-HPA063681)
Datasheet Anti PPP6R1 pAb (ATL-HPA063681) Datasheet (External Link)
Vendor Page Anti PPP6R1 pAb (ATL-HPA063681)