Anti PPP6C pAb (ATL-HPA050940)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050940-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPP6C
Alternative Gene Name: PP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026753: 100%, ENSRNOG00000015145: 100%
Entrez Gene ID: 5537
Uniprot ID: O00743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL |
Gene Sequence | CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL |
Gene ID - Mouse | ENSMUSG00000026753 |
Gene ID - Rat | ENSRNOG00000015145 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPP6C pAb (ATL-HPA050940) | |
Datasheet | Anti PPP6C pAb (ATL-HPA050940) Datasheet (External Link) |
Vendor Page | Anti PPP6C pAb (ATL-HPA050940) at Atlas Antibodies |
Documents & Links for Anti PPP6C pAb (ATL-HPA050940) | |
Datasheet | Anti PPP6C pAb (ATL-HPA050940) Datasheet (External Link) |
Vendor Page | Anti PPP6C pAb (ATL-HPA050940) |
Citations for Anti PPP6C pAb (ATL-HPA050940) – 1 Found |
Nacke, Marisa; Sandilands, Emma; Nikolatou, Konstantina; Román-Fernández, Álvaro; Mason, Susan; Patel, Rachana; Lilla, Sergio; Yelland, Tamas; Galbraith, Laura C A; Freckmann, Eva C; McGarry, Lynn; Morton, Jennifer P; Shanks, Emma; Leung, Hing Y; Markert, Elke; Ismail, Shehab; Zanivan, Sara; Blyth, Karen; Bryant, David M. An ARF GTPase module promoting invasion and metastasis through regulating phosphoinositide metabolism. Nature Communications. 2021;12(1):1623. PubMed |