Anti PPP4R3A pAb (ATL-HPA063917)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063917-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 100%, ENSRNOG00000027773: 100%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME |
Gene Sequence | KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME |
Gene ID - Mouse | ENSMUSG00000041846 |
Gene ID - Rat | ENSRNOG00000027773 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPP4R3A pAb (ATL-HPA063917) | |
Datasheet | Anti PPP4R3A pAb (ATL-HPA063917) Datasheet (External Link) |
Vendor Page | Anti PPP4R3A pAb (ATL-HPA063917) at Atlas Antibodies |
Documents & Links for Anti PPP4R3A pAb (ATL-HPA063917) | |
Datasheet | Anti PPP4R3A pAb (ATL-HPA063917) Datasheet (External Link) |
Vendor Page | Anti PPP4R3A pAb (ATL-HPA063917) |