Anti PPP3CB pAb (ATL-HPA008823)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008823-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PPP3CB
Alternative Gene Name: CALNA2, CALNB, CNA2, PP2Bbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021816: 99%, ENSRNOG00000054782: 91%
Entrez Gene ID: 5532
Uniprot ID: P16298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV |
| Gene Sequence | ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV |
| Gene ID - Mouse | ENSMUSG00000021816 |
| Gene ID - Rat | ENSRNOG00000054782 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP3CB pAb (ATL-HPA008823) | |
| Datasheet | Anti PPP3CB pAb (ATL-HPA008823) Datasheet (External Link) |
| Vendor Page | Anti PPP3CB pAb (ATL-HPA008823) at Atlas Antibodies |
| Documents & Links for Anti PPP3CB pAb (ATL-HPA008823) | |
| Datasheet | Anti PPP3CB pAb (ATL-HPA008823) Datasheet (External Link) |
| Vendor Page | Anti PPP3CB pAb (ATL-HPA008823) |
| Citations for Anti PPP3CB pAb (ATL-HPA008823) – 1 Found |
| Luo, Liyun; Zhang, Zhijie; Qiu, Ni; Ling, Li; Jia, Xiaoting; Song, Ying; Li, Hongsheng; Li, Jiansheng; Lyu, Hui; Liu, Hao; He, Zhimin; Liu, Bolin; Zheng, Guopei. Disruption of FOXO3a-miRNA feedback inhibition of IGF2/IGF-1R/IRS1 signaling confers Herceptin resistance in HER2-positive breast cancer. Nature Communications. 2021;12(1):2699. PubMed |