Anti PPP3CB pAb (ATL-HPA008823)

Atlas Antibodies

Catalog No.:
ATL-HPA008823-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 3, catalytic subunit, beta isozyme
Gene Name: PPP3CB
Alternative Gene Name: CALNA2, CALNB, CNA2, PP2Bbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021816: 99%, ENSRNOG00000054782: 91%
Entrez Gene ID: 5532
Uniprot ID: P16298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
Gene Sequence ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
Gene ID - Mouse ENSMUSG00000021816
Gene ID - Rat ENSRNOG00000054782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP3CB pAb (ATL-HPA008823)
Datasheet Anti PPP3CB pAb (ATL-HPA008823) Datasheet (External Link)
Vendor Page Anti PPP3CB pAb (ATL-HPA008823) at Atlas Antibodies

Documents & Links for Anti PPP3CB pAb (ATL-HPA008823)
Datasheet Anti PPP3CB pAb (ATL-HPA008823) Datasheet (External Link)
Vendor Page Anti PPP3CB pAb (ATL-HPA008823)
Citations for Anti PPP3CB pAb (ATL-HPA008823) – 1 Found
Luo, Liyun; Zhang, Zhijie; Qiu, Ni; Ling, Li; Jia, Xiaoting; Song, Ying; Li, Hongsheng; Li, Jiansheng; Lyu, Hui; Liu, Hao; He, Zhimin; Liu, Bolin; Zheng, Guopei. Disruption of FOXO3a-miRNA feedback inhibition of IGF2/IGF-1R/IRS1 signaling confers Herceptin resistance in HER2-positive breast cancer. Nature Communications. 2021;12(1):2699.  PubMed