Anti PPP3CB pAb (ATL-HPA008233)

Atlas Antibodies

Catalog No.: ATL-HPA008233-25

Protein Description: protein phosphatase 3, catalytic subunit, beta isozyme
Gene Name: PPP3CB
Alternative Gene Name: CALNA2, CALNB, CNA2, PP2Bbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021816: 99%, ENSRNOG00000054782: 91%
Entrez Gene ID: 5532
Uniprot ID: P16298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
• Gene Sequence: ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
• Gene ID - Mouse: ENSMUSG00000021816
• Gene ID - Rat: ENSRNOG00000054782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.