Anti PPP3CA pAb (ATL-HPA012778 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012778-100

Protein Description: protein phosphatase 3, catalytic subunit, alpha isozyme
Gene Name: PPP3CA
Alternative Gene Name: CALN, CALNA, CNA1, PPP2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028161: 100%, ENSRNOG00000009882: 100%
Entrez Gene ID: 5530
Uniprot ID: Q08209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
• Gene Sequence: SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
• Gene ID - Mouse: ENSMUSG00000028161
• Gene ID - Rat: ENSRNOG00000009882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP3CA pAb (ATL-HPA012778 w/enhanced validation) – 2 Found

Mishra, Ajay; Oulès, Bénédicte; Pisco, Angela Oliveira; Ly, Tony; Liakath-Ali, Kifayathullah; Walko, Gernot; Viswanathan, Priyalakshmi; Tihy, Matthieu; Nijjher, Jagdeesh; Dunn, Sara-Jane; Lamond, Angus I; Watt, Fiona M. A protein phosphatase network controls the temporal and spatial dynamics of differentiation commitment in human epidermis. Elife. 2017;6( 29043977) 

Yan, Hai-Biao; Zhang, Yu; Cen, Jie-Mei; Wang, Xiao; Gan, Bin-Liang; Huang, Jia-Cheng; Li, Jia-Yi; Song, Qian-Hui; Li, Sheng-Hua; Chen, Gang. Expression of microRNA-99a-3p in Prostate Cancer Based on Bioinformatics Data and Meta-Analysis of a Literature Review of 965 Cases. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2018;24( 29997385):4807-4822.