Anti PPP2R5C pAb (ATL-HPA027553)

Atlas Antibodies

Catalog No.:
ATL-HPA027553-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 2, regulatory subunit B', gamma
Gene Name: PPP2R5C
Alternative Gene Name: B56G, PR61G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017843: 96%, ENSRNOG00000004973: 70%
Entrez Gene ID: 5527
Uniprot ID: Q13362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Gene Sequence YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Gene ID - Mouse ENSMUSG00000017843
Gene ID - Rat ENSRNOG00000004973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP2R5C pAb (ATL-HPA027553)
Datasheet Anti PPP2R5C pAb (ATL-HPA027553) Datasheet (External Link)
Vendor Page Anti PPP2R5C pAb (ATL-HPA027553) at Atlas Antibodies

Documents & Links for Anti PPP2R5C pAb (ATL-HPA027553)
Datasheet Anti PPP2R5C pAb (ATL-HPA027553) Datasheet (External Link)
Vendor Page Anti PPP2R5C pAb (ATL-HPA027553)