Anti PPP2R3C pAb (ATL-HPA058834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058834-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP2R3C
Alternative Gene Name: C14orf10, FLJ20644, G4-1, G5PR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021022: 96%, ENSRNOG00000023591: 95%
Entrez Gene ID: 55012
Uniprot ID: Q969Q6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF |
| Gene Sequence | LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF |
| Gene ID - Mouse | ENSMUSG00000021022 |
| Gene ID - Rat | ENSRNOG00000023591 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP2R3C pAb (ATL-HPA058834) | |
| Datasheet | Anti PPP2R3C pAb (ATL-HPA058834) Datasheet (External Link) |
| Vendor Page | Anti PPP2R3C pAb (ATL-HPA058834) at Atlas Antibodies |
| Documents & Links for Anti PPP2R3C pAb (ATL-HPA058834) | |
| Datasheet | Anti PPP2R3C pAb (ATL-HPA058834) Datasheet (External Link) |
| Vendor Page | Anti PPP2R3C pAb (ATL-HPA058834) |