Anti PPP2R3A pAb (ATL-HPA065338)

Atlas Antibodies

Catalog No.:
ATL-HPA065338-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 2, regulatory subunit B'', alpha
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA
Gene Sequence FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA
Gene ID - Mouse ENSMUSG00000043154
Gene ID - Rat ENSRNOG00000022999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338)
Datasheet Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link)
Vendor Page Anti PPP2R3A pAb (ATL-HPA065338) at Atlas Antibodies

Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338)
Datasheet Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link)
Vendor Page Anti PPP2R3A pAb (ATL-HPA065338)