Anti PPP2R3A pAb (ATL-HPA065338)

Atlas Antibodies

Catalog No.: ATL-HPA065338-25

Protein Description: protein phosphatase 2, regulatory subunit B'', alpha
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA
• Gene Sequence: FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA
• Gene ID - Mouse: ENSMUSG00000043154
• Gene ID - Rat: ENSRNOG00000022999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.