Anti PPP1R9A pAb (ATL-HPA075591)

Atlas Antibodies

Catalog No.:
ATL-HPA075591-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1 regulatory subunit 9A
Gene Name: PPP1R9A
Alternative Gene Name: FLJ20068, KIAA1222, Neurabin-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032827: 94%, ENSRNOG00000008869: 94%
Entrez Gene ID: 55607
Uniprot ID: Q9ULJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Gene Sequence KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Gene ID - Mouse ENSMUSG00000032827
Gene ID - Rat ENSRNOG00000008869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591)
Datasheet Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link)
Vendor Page Anti PPP1R9A pAb (ATL-HPA075591) at Atlas Antibodies

Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591)
Datasheet Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link)
Vendor Page Anti PPP1R9A pAb (ATL-HPA075591)