Anti PPP1R9A pAb (ATL-HPA075591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075591-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP1R9A
Alternative Gene Name: FLJ20068, KIAA1222, Neurabin-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032827: 94%, ENSRNOG00000008869: 94%
Entrez Gene ID: 55607
Uniprot ID: Q9ULJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS |
| Gene Sequence | KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS |
| Gene ID - Mouse | ENSMUSG00000032827 |
| Gene ID - Rat | ENSRNOG00000008869 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591) | |
| Datasheet | Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link) |
| Vendor Page | Anti PPP1R9A pAb (ATL-HPA075591) at Atlas Antibodies |
| Documents & Links for Anti PPP1R9A pAb (ATL-HPA075591) | |
| Datasheet | Anti PPP1R9A pAb (ATL-HPA075591) Datasheet (External Link) |
| Vendor Page | Anti PPP1R9A pAb (ATL-HPA075591) |