Anti PPP1R3E pAb (ATL-HPA061600)

Atlas Antibodies

Catalog No.: ATL-HPA061600-25

Protein Description: protein phosphatase 1, regulatory subunit 3E
Gene Name: PPP1R3E
Alternative Gene Name: FLJ00089
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072494: 93%, ENSRNOG00000014904: 90%
Entrez Gene ID: 90673
Uniprot ID: Q9H7J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP
• Gene Sequence: MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP
• Gene ID - Mouse: ENSMUSG00000072494
• Gene ID - Rat: ENSRNOG00000014904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.