Anti PPP1R3E pAb (ATL-HPA061600)

Atlas Antibodies

Catalog No.:
ATL-HPA061600-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 3E
Gene Name: PPP1R3E
Alternative Gene Name: FLJ00089
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072494: 93%, ENSRNOG00000014904: 90%
Entrez Gene ID: 90673
Uniprot ID: Q9H7J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP
Gene Sequence MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP
Gene ID - Mouse ENSMUSG00000072494
Gene ID - Rat ENSRNOG00000014904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R3E pAb (ATL-HPA061600)
Datasheet Anti PPP1R3E pAb (ATL-HPA061600) Datasheet (External Link)
Vendor Page Anti PPP1R3E pAb (ATL-HPA061600) at Atlas Antibodies

Documents & Links for Anti PPP1R3E pAb (ATL-HPA061600)
Datasheet Anti PPP1R3E pAb (ATL-HPA061600) Datasheet (External Link)
Vendor Page Anti PPP1R3E pAb (ATL-HPA061600)