Anti PPP1R3E pAb (ATL-HPA061600)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061600-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP1R3E
Alternative Gene Name: FLJ00089
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072494: 93%, ENSRNOG00000014904: 90%
Entrez Gene ID: 90673
Uniprot ID: Q9H7J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP |
| Gene Sequence | MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP |
| Gene ID - Mouse | ENSMUSG00000072494 |
| Gene ID - Rat | ENSRNOG00000014904 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R3E pAb (ATL-HPA061600) | |
| Datasheet | Anti PPP1R3E pAb (ATL-HPA061600) Datasheet (External Link) |
| Vendor Page | Anti PPP1R3E pAb (ATL-HPA061600) at Atlas Antibodies |
| Documents & Links for Anti PPP1R3E pAb (ATL-HPA061600) | |
| Datasheet | Anti PPP1R3E pAb (ATL-HPA061600) Datasheet (External Link) |
| Vendor Page | Anti PPP1R3E pAb (ATL-HPA061600) |