Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA073138-25
  • Immunohistochemistry analysis in human skeletal muscle and smooth muscle tissues using Anti-PPP1R3A antibody. Corresponding PPP1R3A RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1 regulatory subunit 3A
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 45%, ENSRNOG00000059350: 49%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
Gene Sequence EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
Gene ID - Mouse ENSMUSG00000042717
Gene ID - Rat ENSRNOG00000059350
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation)
Datasheet Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation)