Anti PPP1R27 pAb (ATL-HPA048632)

Atlas Antibodies

Catalog No.:
ATL-HPA048632-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 27
Gene Name: PPP1R27
Alternative Gene Name: DYSFIP1, toonin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025129: 90%, ENSRNOG00000036690: 93%
Entrez Gene ID: 116729
Uniprot ID: Q86WC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Gene Sequence YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Gene ID - Mouse ENSMUSG00000025129
Gene ID - Rat ENSRNOG00000036690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R27 pAb (ATL-HPA048632)
Datasheet Anti PPP1R27 pAb (ATL-HPA048632) Datasheet (External Link)
Vendor Page Anti PPP1R27 pAb (ATL-HPA048632) at Atlas Antibodies

Documents & Links for Anti PPP1R27 pAb (ATL-HPA048632)
Datasheet Anti PPP1R27 pAb (ATL-HPA048632) Datasheet (External Link)
Vendor Page Anti PPP1R27 pAb (ATL-HPA048632)