Anti PPP1R21 pAb (ATL-HPA036791)

Atlas Antibodies

Catalog No.:
ATL-HPA036791-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 21
Gene Name: PPP1R21
Alternative Gene Name: CCDC128, FLJ16566, KLRAQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034709: 75%, ENSRNOG00000016528: 78%
Entrez Gene ID: 129285
Uniprot ID: Q6ZMI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDEATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDL
Gene Sequence WMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDEATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDL
Gene ID - Mouse ENSMUSG00000034709
Gene ID - Rat ENSRNOG00000016528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R21 pAb (ATL-HPA036791)
Datasheet Anti PPP1R21 pAb (ATL-HPA036791) Datasheet (External Link)
Vendor Page Anti PPP1R21 pAb (ATL-HPA036791) at Atlas Antibodies

Documents & Links for Anti PPP1R21 pAb (ATL-HPA036791)
Datasheet Anti PPP1R21 pAb (ATL-HPA036791) Datasheet (External Link)
Vendor Page Anti PPP1R21 pAb (ATL-HPA036791)
Citations for Anti PPP1R21 pAb (ATL-HPA036791) – 1 Found
Rehman, Atteeq U; Najafi, Maryam; Kambouris, Marios; Al-Gazali, Lihadh; Makrythanasis, Periklis; Rad, Abolfazl; Maroofian, Reza; Rajab, Anna; Stark, Zornitza; Hunter, Jill V; Bakey, Zeineb; Tokita, Mari J; He, Weimin; Vetrini, Francesco; Petersen, Andrea; Santoni, Federico A; Hamamy, Hanan; Wu, Kaman; Al-Jasmi, Fatma; Helmstädter, Martin; Arnold, Sebastian J; Xia, Fan; Richmond, Christopher; Liu, Pengfei; Karimiani, Ehsan Ghayoor; Karami Madani, GholamReza; Lunke, Sebastian; El-Shanti, Hatem; Eng, Christine M; Antonarakis, Stylianos E; Hertecant, Jozef; Walkiewicz, Magdalena; Yang, Yaping; Schmidts, Miriam. Biallelic loss of function variants in PPP1R21 cause a neurodevelopmental syndrome with impaired endocytic function. Human Mutation. 2019;40(3):267-280.  PubMed