Anti PPP1R1C pAb (ATL-HPA055043)

Atlas Antibodies

Catalog No.: ATL-HPA055043-25

Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 1C
Gene Name: PPP1R1C
Alternative Gene Name: Inhibitor-1-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034683: 82%, ENSRNOG00000024990: 84%
Entrez Gene ID: 151242
Uniprot ID: Q8WVI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
• Gene Sequence: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
• Gene ID - Mouse: ENSMUSG00000034683
• Gene ID - Rat: ENSRNOG00000024990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.