Anti PPP1R1B pAb (ATL-HPA061142)

Atlas Antibodies

Catalog No.:
ATL-HPA061142-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 1B
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061718: 77%, ENSRNOG00000028404: 75%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Gene Sequence EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Gene ID - Mouse ENSMUSG00000061718
Gene ID - Rat ENSRNOG00000028404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R1B pAb (ATL-HPA061142)
Datasheet Anti PPP1R1B pAb (ATL-HPA061142) Datasheet (External Link)
Vendor Page Anti PPP1R1B pAb (ATL-HPA061142) at Atlas Antibodies

Documents & Links for Anti PPP1R1B pAb (ATL-HPA061142)
Datasheet Anti PPP1R1B pAb (ATL-HPA061142) Datasheet (External Link)
Vendor Page Anti PPP1R1B pAb (ATL-HPA061142)