Anti PPP1R1B pAb (ATL-HPA061142)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061142-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061718: 77%, ENSRNOG00000028404: 75%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG |
| Gene Sequence | EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG |
| Gene ID - Mouse | ENSMUSG00000061718 |
| Gene ID - Rat | ENSRNOG00000028404 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R1B pAb (ATL-HPA061142) | |
| Datasheet | Anti PPP1R1B pAb (ATL-HPA061142) Datasheet (External Link) |
| Vendor Page | Anti PPP1R1B pAb (ATL-HPA061142) at Atlas Antibodies |
| Documents & Links for Anti PPP1R1B pAb (ATL-HPA061142) | |
| Datasheet | Anti PPP1R1B pAb (ATL-HPA061142) Datasheet (External Link) |
| Vendor Page | Anti PPP1R1B pAb (ATL-HPA061142) |