Anti PPP1R1B pAb (ATL-HPA048630)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048630-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061718: 87%, ENSRNOG00000028404: 91%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE |
Gene Sequence | PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE |
Gene ID - Mouse | ENSMUSG00000061718 |
Gene ID - Rat | ENSRNOG00000028404 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPP1R1B pAb (ATL-HPA048630) | |
Datasheet | Anti PPP1R1B pAb (ATL-HPA048630) Datasheet (External Link) |
Vendor Page | Anti PPP1R1B pAb (ATL-HPA048630) at Atlas Antibodies |
Documents & Links for Anti PPP1R1B pAb (ATL-HPA048630) | |
Datasheet | Anti PPP1R1B pAb (ATL-HPA048630) Datasheet (External Link) |
Vendor Page | Anti PPP1R1B pAb (ATL-HPA048630) |