Anti PPP1R17 pAb (ATL-HPA073123)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073123-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 81%, ENSRNOG00000012235: 81%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS |
Gene Sequence | PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS |
Gene ID - Mouse | ENSMUSG00000002930 |
Gene ID - Rat | ENSRNOG00000012235 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123) | |
Datasheet | Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link) |
Vendor Page | Anti PPP1R17 pAb (ATL-HPA073123) at Atlas Antibodies |
Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123) | |
Datasheet | Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link) |
Vendor Page | Anti PPP1R17 pAb (ATL-HPA073123) |