Anti PPP1R17 pAb (ATL-HPA073123)

Atlas Antibodies

Catalog No.:
ATL-HPA073123-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1 regulatory subunit 17
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 81%, ENSRNOG00000012235: 81%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS
Gene Sequence PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS
Gene ID - Mouse ENSMUSG00000002930
Gene ID - Rat ENSRNOG00000012235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123)
Datasheet Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link)
Vendor Page Anti PPP1R17 pAb (ATL-HPA073123) at Atlas Antibodies

Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123)
Datasheet Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link)
Vendor Page Anti PPP1R17 pAb (ATL-HPA073123)