Anti PPP1R17 pAb (ATL-HPA073123)

Atlas Antibodies

Catalog No.: ATL-HPA073123-25

Protein Description: protein phosphatase 1 regulatory subunit 17
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 81%, ENSRNOG00000012235: 81%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS
• Gene Sequence: PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS
• Gene ID - Mouse: ENSMUSG00000002930
• Gene ID - Rat: ENSRNOG00000012235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.