Anti PPP1R16B pAb (ATL-HPA079512)

Atlas Antibodies

Catalog No.:
ATL-HPA079512-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1 regulatory subunit 16B
Gene Name: PPP1R16B
Alternative Gene Name: ANKRD4, KIAA0823, TIMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037754: 97%, ENSRNOG00000015614: 96%
Entrez Gene ID: 26051
Uniprot ID: Q96T49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI
Gene Sequence RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI
Gene ID - Mouse ENSMUSG00000037754
Gene ID - Rat ENSRNOG00000015614
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R16B pAb (ATL-HPA079512)
Datasheet Anti PPP1R16B pAb (ATL-HPA079512) Datasheet (External Link)
Vendor Page Anti PPP1R16B pAb (ATL-HPA079512) at Atlas Antibodies

Documents & Links for Anti PPP1R16B pAb (ATL-HPA079512)
Datasheet Anti PPP1R16B pAb (ATL-HPA079512) Datasheet (External Link)
Vendor Page Anti PPP1R16B pAb (ATL-HPA079512)