Anti PPP1R15B pAb (ATL-HPA061088)

Atlas Antibodies

Catalog No.: ATL-HPA061088-25

Protein Description: protein phosphatase 1, regulatory subunit 15B
Gene Name: PPP1R15B
Alternative Gene Name: FLJ14744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046062: 77%, ENSRNOG00000028493: 74%
Entrez Gene ID: 84919
Uniprot ID: Q5SWA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE
• Gene Sequence: CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE
• Gene ID - Mouse: ENSMUSG00000046062
• Gene ID - Rat: ENSRNOG00000028493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.