Anti PPP1R15B pAb (ATL-HPA061088)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061088-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPP1R15B
Alternative Gene Name: FLJ14744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046062: 77%, ENSRNOG00000028493: 74%
Entrez Gene ID: 84919
Uniprot ID: Q5SWA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE |
| Gene Sequence | CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE |
| Gene ID - Mouse | ENSMUSG00000046062 |
| Gene ID - Rat | ENSRNOG00000028493 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R15B pAb (ATL-HPA061088) | |
| Datasheet | Anti PPP1R15B pAb (ATL-HPA061088) Datasheet (External Link) |
| Vendor Page | Anti PPP1R15B pAb (ATL-HPA061088) at Atlas Antibodies |
| Documents & Links for Anti PPP1R15B pAb (ATL-HPA061088) | |
| Datasheet | Anti PPP1R15B pAb (ATL-HPA061088) Datasheet (External Link) |
| Vendor Page | Anti PPP1R15B pAb (ATL-HPA061088) |