Anti PPP1R14A pAb (ATL-HPA054534)

Atlas Antibodies

Catalog No.: ATL-HPA054534-25

Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 14A
Gene Name: PPP1R14A
Alternative Gene Name: CPI-17, PPP1INL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037166: 71%, ENSRNOG00000020676: 71%
Entrez Gene ID: 94274
Uniprot ID: Q96A00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
• Gene Sequence: GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
• Gene ID - Mouse: ENSMUSG00000037166
• Gene ID - Rat: ENSRNOG00000020676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.