Anti PPP1R14A pAb (ATL-HPA054534)

Atlas Antibodies

Catalog No.:
ATL-HPA054534-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 14A
Gene Name: PPP1R14A
Alternative Gene Name: CPI-17, PPP1INL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037166: 71%, ENSRNOG00000020676: 71%
Entrez Gene ID: 94274
Uniprot ID: Q96A00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
Gene Sequence GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
Gene ID - Mouse ENSMUSG00000037166
Gene ID - Rat ENSRNOG00000020676
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R14A pAb (ATL-HPA054534)
Datasheet Anti PPP1R14A pAb (ATL-HPA054534) Datasheet (External Link)
Vendor Page Anti PPP1R14A pAb (ATL-HPA054534) at Atlas Antibodies

Documents & Links for Anti PPP1R14A pAb (ATL-HPA054534)
Datasheet Anti PPP1R14A pAb (ATL-HPA054534) Datasheet (External Link)
Vendor Page Anti PPP1R14A pAb (ATL-HPA054534)