Anti PPP1R14A pAb (ATL-HPA054534)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054534-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP1R14A
Alternative Gene Name: CPI-17, PPP1INL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037166: 71%, ENSRNOG00000020676: 71%
Entrez Gene ID: 94274
Uniprot ID: Q96A00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS |
| Gene Sequence | GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS |
| Gene ID - Mouse | ENSMUSG00000037166 |
| Gene ID - Rat | ENSRNOG00000020676 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R14A pAb (ATL-HPA054534) | |
| Datasheet | Anti PPP1R14A pAb (ATL-HPA054534) Datasheet (External Link) |
| Vendor Page | Anti PPP1R14A pAb (ATL-HPA054534) at Atlas Antibodies |
| Documents & Links for Anti PPP1R14A pAb (ATL-HPA054534) | |
| Datasheet | Anti PPP1R14A pAb (ATL-HPA054534) Datasheet (External Link) |
| Vendor Page | Anti PPP1R14A pAb (ATL-HPA054534) |