Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056756-25
  • Immunohistochemical staining of human colon, kidney, skin and testis using Anti-PPP1R10 antibody HPA056756 (A) shows similar protein distribution across tissues to independent antibody HPA047248 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 10
Gene Name: PPP1R10
Alternative Gene Name: CAT53, FB19, p99, PNUTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039220: 96%, ENSRNOG00000059268: 97%
Entrez Gene ID: 5514
Uniprot ID: Q96QC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV
Gene Sequence LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV
Gene ID - Mouse ENSMUSG00000039220
Gene ID - Rat ENSRNOG00000059268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation)
Datasheet Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation)