Anti PPM1M pAb (ATL-HPA062291)

Atlas Antibodies

Catalog No.:
ATL-HPA062291-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1M
Gene Name: PPM1M
Alternative Gene Name: FLJ32332, PP2Ceta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020253: 90%, ENSRNOG00000046535: 90%
Entrez Gene ID: 132160
Uniprot ID: Q96MI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA
Gene Sequence AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA
Gene ID - Mouse ENSMUSG00000020253
Gene ID - Rat ENSRNOG00000046535
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPM1M pAb (ATL-HPA062291)
Datasheet Anti PPM1M pAb (ATL-HPA062291) Datasheet (External Link)
Vendor Page Anti PPM1M pAb (ATL-HPA062291) at Atlas Antibodies

Documents & Links for Anti PPM1M pAb (ATL-HPA062291)
Datasheet Anti PPM1M pAb (ATL-HPA062291) Datasheet (External Link)
Vendor Page Anti PPM1M pAb (ATL-HPA062291)