Anti PPM1H pAb (ATL-HPA058777)

Atlas Antibodies

Catalog No.: ATL-HPA058777-25

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1H
Gene Name: PPM1H
Alternative Gene Name: ARHCL1, FLJ13253, KIAA1157, NERPP-2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034613: 96%, ENSRNOG00000004314: 96%
Entrez Gene ID: 57460
Uniprot ID: Q9ULR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
• Gene Sequence: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
• Gene ID - Mouse: ENSMUSG00000034613
• Gene ID - Rat: ENSRNOG00000004314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.