Anti PPM1H pAb (ATL-HPA058777)

Atlas Antibodies

Catalog No.:
ATL-HPA058777-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1H
Gene Name: PPM1H
Alternative Gene Name: ARHCL1, FLJ13253, KIAA1157, NERPP-2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034613: 96%, ENSRNOG00000004314: 96%
Entrez Gene ID: 57460
Uniprot ID: Q9ULR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
Gene Sequence MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
Gene ID - Mouse ENSMUSG00000034613
Gene ID - Rat ENSRNOG00000004314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPM1H pAb (ATL-HPA058777)
Datasheet Anti PPM1H pAb (ATL-HPA058777) Datasheet (External Link)
Vendor Page Anti PPM1H pAb (ATL-HPA058777) at Atlas Antibodies

Documents & Links for Anti PPM1H pAb (ATL-HPA058777)
Datasheet Anti PPM1H pAb (ATL-HPA058777) Datasheet (External Link)
Vendor Page Anti PPM1H pAb (ATL-HPA058777)