Anti PPM1E pAb (ATL-HPA019263)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019263-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPM1E
Alternative Gene Name: CaMKP-N, KIAA1072, POPX1, PP2CH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046442: 95%, ENSRNOG00000024730: 98%
Entrez Gene ID: 22843
Uniprot ID: Q8WY54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE |
| Gene Sequence | TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE |
| Gene ID - Mouse | ENSMUSG00000046442 |
| Gene ID - Rat | ENSRNOG00000024730 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPM1E pAb (ATL-HPA019263) | |
| Datasheet | Anti PPM1E pAb (ATL-HPA019263) Datasheet (External Link) |
| Vendor Page | Anti PPM1E pAb (ATL-HPA019263) at Atlas Antibodies |
| Documents & Links for Anti PPM1E pAb (ATL-HPA019263) | |
| Datasheet | Anti PPM1E pAb (ATL-HPA019263) Datasheet (External Link) |
| Vendor Page | Anti PPM1E pAb (ATL-HPA019263) |