Anti PPM1E pAb (ATL-HPA019263)

Atlas Antibodies

Catalog No.: ATL-HPA019263-25

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1E
Gene Name: PPM1E
Alternative Gene Name: CaMKP-N, KIAA1072, POPX1, PP2CH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046442: 95%, ENSRNOG00000024730: 98%
Entrez Gene ID: 22843
Uniprot ID: Q8WY54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE
• Gene Sequence: TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE
• Gene ID - Mouse: ENSMUSG00000046442
• Gene ID - Rat: ENSRNOG00000024730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.