Anti PPL pAb (ATL-HPA059859 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059859-25
  • Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-PPL antibody. Corresponding PPL RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: periplakin
Gene Name: PPL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039457: 94%, ENSRNOG00000002930: 94%
Entrez Gene ID: 5493
Uniprot ID: O60437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
Gene Sequence AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
Gene ID - Mouse ENSMUSG00000039457
Gene ID - Rat ENSRNOG00000002930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PPL pAb (ATL-HPA059859 w/enhanced validation)
Datasheet Anti PPL pAb (ATL-HPA059859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPL pAb (ATL-HPA059859 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PPL pAb (ATL-HPA059859 w/enhanced validation)
Datasheet Anti PPL pAb (ATL-HPA059859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPL pAb (ATL-HPA059859 w/enhanced validation)