Anti PPIL3 pAb (ATL-HPA062187)

Atlas Antibodies

Catalog No.:
ATL-HPA062187-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase (cyclophilin)-like 3
Gene Name: PPIL3
Alternative Gene Name: CyPJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026035: 98%, ENSRNOG00000013636: 98%
Entrez Gene ID: 53938
Uniprot ID: Q9H2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQT
Gene Sequence MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQT
Gene ID - Mouse ENSMUSG00000026035
Gene ID - Rat ENSRNOG00000013636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPIL3 pAb (ATL-HPA062187)
Datasheet Anti PPIL3 pAb (ATL-HPA062187) Datasheet (External Link)
Vendor Page Anti PPIL3 pAb (ATL-HPA062187) at Atlas Antibodies

Documents & Links for Anti PPIL3 pAb (ATL-HPA062187)
Datasheet Anti PPIL3 pAb (ATL-HPA062187) Datasheet (External Link)
Vendor Page Anti PPIL3 pAb (ATL-HPA062187)