Anti PPIL1 pAb (ATL-HPA062916)

Atlas Antibodies

Catalog No.:
ATL-HPA062916-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase (cyclophilin)-like 1
Gene Name: PPIL1
Alternative Gene Name: CYPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024007: 98%, ENSRNOG00000000523: 98%
Entrez Gene ID: 51645
Uniprot ID: Q9Y3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Gene Sequence KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Gene ID - Mouse ENSMUSG00000024007
Gene ID - Rat ENSRNOG00000000523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPIL1 pAb (ATL-HPA062916)
Datasheet Anti PPIL1 pAb (ATL-HPA062916) Datasheet (External Link)
Vendor Page Anti PPIL1 pAb (ATL-HPA062916) at Atlas Antibodies

Documents & Links for Anti PPIL1 pAb (ATL-HPA062916)
Datasheet Anti PPIL1 pAb (ATL-HPA062916) Datasheet (External Link)
Vendor Page Anti PPIL1 pAb (ATL-HPA062916)