Anti PPIH pAb (ATL-HPA059019)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059019-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PPIH
Alternative Gene Name: CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033036: 100%, ENSRNOG00000008489: 100%
Entrez Gene ID: 10465
Uniprot ID: O43447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Gene Sequence | VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Gene ID - Mouse | ENSMUSG00000033036 |
| Gene ID - Rat | ENSRNOG00000008489 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPIH pAb (ATL-HPA059019) | |
| Datasheet | Anti PPIH pAb (ATL-HPA059019) Datasheet (External Link) |
| Vendor Page | Anti PPIH pAb (ATL-HPA059019) at Atlas Antibodies |
| Documents & Links for Anti PPIH pAb (ATL-HPA059019) | |
| Datasheet | Anti PPIH pAb (ATL-HPA059019) Datasheet (External Link) |
| Vendor Page | Anti PPIH pAb (ATL-HPA059019) |