Anti PPIH pAb (ATL-HPA059019)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059019-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PPIH
Alternative Gene Name: CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033036: 100%, ENSRNOG00000008489: 100%
Entrez Gene ID: 10465
Uniprot ID: O43447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
Gene Sequence | VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
Gene ID - Mouse | ENSMUSG00000033036 |
Gene ID - Rat | ENSRNOG00000008489 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPIH pAb (ATL-HPA059019) | |
Datasheet | Anti PPIH pAb (ATL-HPA059019) Datasheet (External Link) |
Vendor Page | Anti PPIH pAb (ATL-HPA059019) at Atlas Antibodies |
Documents & Links for Anti PPIH pAb (ATL-HPA059019) | |
Datasheet | Anti PPIH pAb (ATL-HPA059019) Datasheet (External Link) |
Vendor Page | Anti PPIH pAb (ATL-HPA059019) |