Anti PPIG pAb (ATL-HPA057469)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057469-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPIG
Alternative Gene Name: CARS-Cyp, SCAF10, SRCyp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042133: 90%, ENSRNOG00000007673: 91%
Entrez Gene ID: 9360
Uniprot ID: Q13427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS |
Gene Sequence | QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS |
Gene ID - Mouse | ENSMUSG00000042133 |
Gene ID - Rat | ENSRNOG00000007673 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPIG pAb (ATL-HPA057469) | |
Datasheet | Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link) |
Vendor Page | Anti PPIG pAb (ATL-HPA057469) at Atlas Antibodies |
Documents & Links for Anti PPIG pAb (ATL-HPA057469) | |
Datasheet | Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link) |
Vendor Page | Anti PPIG pAb (ATL-HPA057469) |