Anti PPIG pAb (ATL-HPA057469)

Atlas Antibodies

Catalog No.:
ATL-HPA057469-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase G (cyclophilin G)
Gene Name: PPIG
Alternative Gene Name: CARS-Cyp, SCAF10, SRCyp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042133: 90%, ENSRNOG00000007673: 91%
Entrez Gene ID: 9360
Uniprot ID: Q13427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
Gene Sequence QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
Gene ID - Mouse ENSMUSG00000042133
Gene ID - Rat ENSRNOG00000007673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPIG pAb (ATL-HPA057469)
Datasheet Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link)
Vendor Page Anti PPIG pAb (ATL-HPA057469) at Atlas Antibodies

Documents & Links for Anti PPIG pAb (ATL-HPA057469)
Datasheet Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link)
Vendor Page Anti PPIG pAb (ATL-HPA057469)