Anti PPIG pAb (ATL-HPA057469)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057469-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPIG
Alternative Gene Name: CARS-Cyp, SCAF10, SRCyp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042133: 90%, ENSRNOG00000007673: 91%
Entrez Gene ID: 9360
Uniprot ID: Q13427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS |
| Gene Sequence | QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS |
| Gene ID - Mouse | ENSMUSG00000042133 |
| Gene ID - Rat | ENSRNOG00000007673 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPIG pAb (ATL-HPA057469) | |
| Datasheet | Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link) |
| Vendor Page | Anti PPIG pAb (ATL-HPA057469) at Atlas Antibodies |
| Documents & Links for Anti PPIG pAb (ATL-HPA057469) | |
| Datasheet | Anti PPIG pAb (ATL-HPA057469) Datasheet (External Link) |
| Vendor Page | Anti PPIG pAb (ATL-HPA057469) |